Lineage for d1exma2 (1exm A:313-405)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. Species Thermus thermophilus [TaxId:274] [50470] (4 PDB entries)
  8. 1544815Domain d1exma2: 1exm A:313-405 [25736]
    Other proteins in same PDB: d1exma1, d1exma3
    protein/RNA complex; complexed with gnp, mg

Details for d1exma2

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.
PDB Compounds: (A:) elongation factor tu (ef-tu)

SCOPe Domain Sequences for d1exma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1exma2:

Click to download the PDB-style file with coordinates for d1exma2.
(The format of our PDB-style files is described here.)

Timeline for d1exma2: