Lineage for d1tttb1 (1ttt B:213-312)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229967Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 229978Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 229979Family b.43.3.1: Elongation factors [50448] (6 proteins)
  6. 230001Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 230016Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 230020Domain d1tttb1: 1ttt B:213-312 [25691]
    Other proteins in same PDB: d1ttta2, d1ttta3, d1tttb2, d1tttb3, d1tttc2, d1tttc3

Details for d1tttb1

PDB Entry: 1ttt (more details), 2.7 Å

PDB Description: phe-trna, elongation factor ef-tu:gdpnp ternary complex

SCOP Domain Sequences for d1tttb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tttb1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1tttb1:

Click to download the PDB-style file with coordinates for d1tttb1.
(The format of our PDB-style files is described here.)

Timeline for d1tttb1: