Lineage for d1efta1 (1eft A:213-312)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126692Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1126772Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1126792Species Thermus aquaticus [TaxId:271] [50451] (5 PDB entries)
  8. 1126794Domain d1efta1: 1eft A:213-312 [25688]
    Other proteins in same PDB: d1efta2, d1efta3
    complexed with gnp, mg

Details for d1efta1

PDB Entry: 1eft (more details), 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efta1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1efta1:

Click to download the PDB-style file with coordinates for d1efta1.
(The format of our PDB-style files is described here.)

Timeline for d1efta1: