![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
![]() | Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries) |
![]() | Domain d1efta1: 1eft A:213-312 [25688] Other proteins in same PDB: d1efta2, d1efta3 complexed with gnp, mg |
PDB Entry: 1eft (more details), 2.5 Å
SCOPe Domain Sequences for d1efta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efta1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvglllrgvsreevergqvlakpgsitp
Timeline for d1efta1: