SCOPe 2.08: Domain d4kmpa1: 4kmp A:256-348

Lineage for d4kmpa1 (4kmp A:256-348)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d4kmpa1: 4kmp A:256-348 [256875]
   Other proteins in same PDB: d4kmpa2, d4kmpb2
   automated match to d2opzb_
   complexed with gt6, zn

Details for d4kmpa1

PDB Entry: 4kmp, 1.95 Å

PDB Description: Structure of XIAP-BIR3 and inhibitor

PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d4kmpa1:

Sequence; same for both SEQRES and ATOM records:

>d4kmpa1 g.52.1.1 (A:256-348) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed
pweqhakwypgckylleqkgqeyinnihlthsl

Timeline for d4kmpa1:

• d4kmpa1 first appeared in SCOPe 2.04, called d4kmpa_
  
• d4kmpa1 appears in SCOPe 2.07