![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein automated matches [190700] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries) |
![]() | Domain d4kmpb1: 4kmp B:256-348 [256876] Other proteins in same PDB: d4kmpa2, d4kmpb2 automated match to d2opzb_ complexed with gt6, zn |
PDB Entry: 4kmp (more details), 1.95 Å
SCOPe Domain Sequences for d4kmpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kmpb1 g.52.1.1 (B:256-348) automated matches {Human (Homo sapiens) [TaxId: 9606]} lprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkpsed pweqhakwypgckylleqkgqeyinnihlthsl
Timeline for d4kmpb1: