Lineage for d4jkxb1 (4jkx B:1-137)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 protein domains)
  6. 1543582Protein automated matches [190608] (3 species)
    not a true protein
  7. 1543603Species European mistletoe (Viscum album) [TaxId:3972] [225471] (5 PDB entries)
  8. 1543612Domain d4jkxb1: 4jkx B:1-137 [256794]
    Other proteins in same PDB: d4jkxa_
    automated match to d1sz6b1
    complexed with azi, cl, dio, edo, gol, h35, nag, so4

Details for d4jkxb1

PDB Entry: 4jkx (more details), 2.35 Å

PDB Description: Crystal structure Mistletoe Lectin I from Viscum album in complex with kinetin at 2.35 A resolution.
PDB Compounds: (B:) Beta-galactoside-specific lectin 1 B chain

SCOPe Domain Sequences for d4jkxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkxb1 b.42.2.1 (B:1-137) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
ddvtcsaseptvrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirs
ngsclttygytagvyvmifdcntavreatiweiwgngtiinprsnlvlaassgikgttlt
vqtldytlgqgwlagnd

SCOPe Domain Coordinates for d4jkxb1:

Click to download the PDB-style file with coordinates for d4jkxb1.
(The format of our PDB-style files is described here.)

Timeline for d4jkxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jkxb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jkxa_