SCOP 1.57: Domain d1cqxb2: 1cqx B:151-261

Lineage for d1cqxb2 (1cqx B:151-261)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Flavohemoglobin, central domain [50436] (1 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [50437] (1 PDB entry)

8. Domain d1cqxb2: 1cqx B:151-261 [25668]
   Other proteins in same PDB: d1cqxa1, d1cqxa3, d1cqxb1, d1cqxb3

Details for d1cqxb2

PDB Entry: 1cqx, 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

SCOP Domain Sequences for d1cqxb2:

Sequence; same for both SEQRES and ATOM records:

>d1cqxb2 b.43.4.2 (B:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus}
wkgwrtfvirekrpesdvitsfilepadggpvvnfepgqytsvaidvpalglqqirqysl
sdmpngrtyrisvkregggpqppgyvsnllhdhvnvgdqvklaapygsfhi

Timeline for d1cqxb2:

• d1cqxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cqxb2 appears in SCOP 1.59
  
• d1cqxb2 appears in the current release, SCOPe 2.08