SCOP 1.57: Domain d1cqxb3: 1cqx B:262-403

Lineage for d1cqxb3 (1cqx B:262-403)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.5: Flavohemoglobin, C-terminal domain [52370] (1 protein)

6. Protein Flavohemoglobin, C-terminal domain [52371] (1 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [52372] (1 PDB entry)

8. Domain d1cqxb3: 1cqx B:262-403 [31563]
   Other proteins in same PDB: d1cqxa1, d1cqxa2, d1cqxb1, d1cqxb2

Details for d1cqxb3

PDB Entry: 1cqx, 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

SCOP Domain Sequences for d1cqxb3:

Sequence; same for both SEQRES and ATOM records:

>d1cqxb3 c.25.1.5 (B:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae

Timeline for d1cqxb3:

• d1cqxb3 first appeared (with stable ids) in SCOP 1.55
  
• d1cqxb3 appears in SCOP 1.59
  
• d1cqxb3 appears in the current release, SCOPe 2.08