SCOPe 2.08: Domain d1cqxb2: 1cqx B:151-261

Lineage for d1cqxb2 (1cqx B:151-261)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Flavohemoglobin, central domain [50436] (2 species)
   contains additional globin domain

7. Species Alcaligenes eutrophus [TaxId:106590] [50437] (1 PDB entry)

8. Domain d1cqxb2: 1cqx B:151-261 [25668]
   Other proteins in same PDB: d1cqxa1, d1cqxa3, d1cqxb1, d1cqxb3
   complexed with dgg, fad, hem, na

Details for d1cqxb2

PDB Entry: 1cqx, 1.75 Å

PDB Description: crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution

PDB Compounds: (B:) flavohemoprotein

SCOPe Domain Sequences for d1cqxb2:

Sequence; same for both SEQRES and ATOM records:

>d1cqxb2 b.43.4.2 (B:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]}
wkgwrtfvirekrpesdvitsfilepadggpvvnfepgqytsvaidvpalglqqirqysl
sdmpngrtyrisvkregggpqppgyvsnllhdhvnvgdqvklaapygsfhi

Timeline for d1cqxb2:

• d1cqxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cqxb2 appears in SCOPe 2.07