Lineage for d4cqjb2 (4cqj B:193-298)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565214Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 1565215Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 1565216Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 1565217Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 1565218Species Streptomyces cattleya [TaxId:29303] [101855] (11 PDB entries)
  8. 1565250Domain d4cqjb2: 4cqj B:193-298 [256654]
    Other proteins in same PDB: d4cqja1, d4cqjb1, d4cqjc1
    automated match to d1rqpa1
    complexed with efa

Details for d4cqjb2

PDB Entry: 4cqj (more details), 2.44 Å

PDB Description: Fluorinase substrate flexibility enables last step aqueous and ambient 18F fluorination of a RGD peptide for positron emission tomography
PDB Compounds: (B:) 5'-fluoro-5'-deoxy-adenosine synthase

SCOPe Domain Sequences for d4cqjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqjb2 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d4cqjb2:

Click to download the PDB-style file with coordinates for d4cqjb2.
(The format of our PDB-style files is described here.)

Timeline for d4cqjb2: