SCOPe 2.08: Domain d4cqjb2: 4cqj B:193-298

Lineage for d4cqjb2 (4cqj B:193-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d4cqjb2: 4cqj B:193-298 [256654]
   Other proteins in same PDB: d4cqja1, d4cqjb1, d4cqjc1
   automated match to d1rqpa1
   complexed with efa

Details for d4cqjb2

PDB Entry: 4cqj, 2.44 Å

PDB Description: Fluorinase substrate flexibility enables last step aqueous and ambient 18F fluorination of a RGD peptide for positron emission tomography

PDB Compounds: (B:) 5'-fluoro-5'-deoxy-adenosine synthase

SCOPe Domain Sequences for d4cqjb2:

Sequence; same for both SEQRES and ATOM records:

>d4cqjb2 b.141.1.1 (B:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d4cqjb2:

• d4cqjb2 first appeared in SCOPe 2.04
  
• d4cqjb2 appears in SCOPe 2.07