Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (24 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226273] (5 PDB entries) |
Domain d4cqha1: 4cqh A:7-129 [256649] Other proteins in same PDB: d4cqha2, d4cqha3 automated match to d2o9ca2 complexed with lbv, na |
PDB Entry: 4cqh (more details), 1.14 Å
SCOPe Domain Sequences for d4cqha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqha1 d.110.3.0 (A:7-129) automated matches {Deinococcus radiodurans [TaxId: 1299]} pffpplylggpeittencerepihipgsiqphgalltadghsgevlqvslnaatflgqep tvlrgqtlaallpdqwpalqtalppgcqdalqyratldwpaaghlsltvhrvaellilef ept
Timeline for d4cqha1: