| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
| Protein automated matches [226861] (3 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries) |
| Domain d4copa_: 4cop A: [256639] automated match to d2xt1a_ mutant |
PDB Entry: 4cop (more details), 1.85 Å
SCOPe Domain Sequences for d4copa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4copa_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ptsildirqgpkepfrdyvdrfsktlraeqasqevknwmtetllvqnanpdcktilkalg
pgatleemmtacqgvggpghkarvl
Timeline for d4copa_: