Lineage for d4copa_ (4cop A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706524Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 2706530Domain d4copa_: 4cop A: [256639]
    automated match to d2xt1a_
    mutant

Details for d4copa_

PDB Entry: 4cop (more details), 1.85 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (y169s)
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4copa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4copa_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ptsildirqgpkepfrdyvdrfsktlraeqasqevknwmtetllvqnanpdcktilkalg
pgatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d4copa_:

Click to download the PDB-style file with coordinates for d4copa_.
(The format of our PDB-style files is described here.)

Timeline for d4copa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4copb_