Lineage for d4cbua2 (4cbu A:148-368)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605420Protein automated matches [226905] (11 species)
    not a true protein
  7. 1605507Species Plasmodium falciparum [TaxId:5833] [256593] (1 PDB entry)
  8. 1605508Domain d4cbua2: 4cbu A:148-368 [256594]
    Other proteins in same PDB: d4cbua1, d4cbug_
    automated match to d3ub5a2
    complexed with atp, ca

Details for d4cbua2

PDB Entry: 4cbu (more details), 1.3 Å

PDB Description: Crystal structure of Plasmodium falciparum actin I
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4cbua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbua2 c.55.1.1 (A:148-368) automated matches {Plasmodium falciparum [TaxId: 5833]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgp

SCOPe Domain Coordinates for d4cbua2:

Click to download the PDB-style file with coordinates for d4cbua2.
(The format of our PDB-style files is described here.)

Timeline for d4cbua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cbua1
View in 3D
Domains from other chains:
(mouse over for more information)
d4cbug_