SCOPe 2.05: Domain d4cbua1: 4cbu A:4-147

Lineage for d4cbua1 (4cbu A:4-147)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256591] (1 PDB entry)

8. Domain d4cbua1: 4cbu A:4-147 [256592]
   Other proteins in same PDB: d4cbua2, d4cbug_
   automated match to d2btfa1
   complexed with atp, ca

Details for d4cbua1

PDB Entry: 4cbu, 1.3 Å

PDB Description: Crystal structure of Plasmodium falciparum actin I

PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4cbua1:

Sequence, based on SEQRES records:

>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkr
giltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqi
mfesfnvpamyvaiqavlslyssg

Sequence, based on observed residues (ATOM records):

>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpkdafvgdeaqtkrgiltlkyp
iehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvp
amyvaiqavlslyssg

Timeline for d4cbua1:

• d4cbua1 first appeared in SCOPe 2.04
  
• d4cbua1 appears in SCOPe 2.06
  
• d4cbua1 appears in the current release, SCOPe 2.08