Lineage for d4cbug_ (4cbu G:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922095Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1922096Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1922097Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 1922219Protein automated matches [226883] (2 species)
    not a true protein
  7. 1922226Species Mouse (Mus musculus) [TaxId:10090] [256589] (2 PDB entries)
  8. 1922227Domain d4cbug_: 4cbu G: [256590]
    Other proteins in same PDB: d4cbua1, d4cbua2
    automated match to d3cipg_
    complexed with atp, ca

Details for d4cbug_

PDB Entry: 4cbu (more details), 1.3 Å

PDB Description: Crystal structure of Plasmodium falciparum actin I
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d4cbug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cbug_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkgg
vasgf

SCOPe Domain Coordinates for d4cbug_:

Click to download the PDB-style file with coordinates for d4cbug_.
(The format of our PDB-style files is described here.)

Timeline for d4cbug_: