Lineage for d4cbua1 (4cbu A:4-147)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138798Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256591] (1 PDB entry)
  8. 2138799Domain d4cbua1: 4cbu A:4-147 [256592]
    Other proteins in same PDB: d4cbua2, d4cbug_
    automated match to d2btfa1
    complexed with atp, ca

Details for d4cbua1

PDB Entry: 4cbu (more details), 1.3 Å

PDB Description: Crystal structure of Plasmodium falciparum actin I
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d4cbua1:

Sequence, based on SEQRES records: (download)

>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkr
giltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqi
mfesfnvpamyvaiqavlslyssg

Sequence, based on observed residues (ATOM records): (download)

>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpkdafvgdeaqtkrgiltlkyp
iehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvp
amyvaiqavlslyssg

SCOPe Domain Coordinates for d4cbua1:

Click to download the PDB-style file with coordinates for d4cbua1.
(The format of our PDB-style files is described here.)

Timeline for d4cbua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cbua2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cbug_