![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species) |
![]() | Domain d1ewyb1: 1ewy B:1-141 [25652] Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_ complexed with fad, fes |
PDB Entry: 1ewy (more details), 2.38 Å
SCOPe Domain Sequences for d1ewyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewyb1 b.43.4.2 (B:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]} tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty lthiepgsevkitgpvgkeml
Timeline for d1ewyb1: