SCOPe 2.08: Domain d1ewya1: 1ewy A:1-141

Lineage for d1ewya1 (1ewy A:1-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)

8. Domain d1ewya1: 1ewy A:1-141 [25651]
   Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_
   complexed with fad, fes

Details for d1ewya1

PDB Entry: 1ewy, 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1ewya1:

Sequence; same for both SEQRES and ATOM records:

>d1ewya1 b.43.4.2 (A:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

Timeline for d1ewya1:

• d1ewya1 first appeared (with stable ids) in SCOP 1.55
  
• d1ewya1 appears in SCOPe 2.07