SCOP 1.55: Domain d1ewyb1: 1ewy B:1-141

Lineage for d1ewyb1 (1ewy B:1-141)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families)

5. Family b.43.1.1: Reductases [50414] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (5 PDB entries)

8. Domain d1ewyb1: 1ewy B:1-141 [25652]
   Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_

Details for d1ewyb1

PDB Entry: 1ewy, 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewyb1:

Sequence; same for both SEQRES and ATOM records:

>d1ewyb1 b.43.1.1 (B:1-141) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

Timeline for d1ewyb1:

• d1ewyb1 appears in SCOP 1.57
  
• d1ewyb1 appears in the current release, SCOPe 2.08