Lineage for d3tldb_ (3tld B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1473140Protein Bacterial dimeric hemoglobin [46526] (1 species)
  7. 1473141Species Vitreoscilla stercoraria [TaxId:61] [46527] (7 PDB entries)
  8. 1473151Domain d3tldb_: 3tld B: [256453]
    automated match to d4vhba_
    complexed with gol, hem; mutant

Details for d3tldb_

PDB Entry: 3tld (more details), 1.9 Å

PDB Description: crystal structure of y29f mutant of vitreoscilla hemoglobin
PDB Compounds: (B:) Bacterial hemoglobin

SCOPe Domain Sequences for d3tldb_:

Sequence, based on SEQRES records: (download)

>d3tldb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
mldqqtiniikatvpvlkehgvtitttffknlfakhpevrplfdmgrqesleqpkalamt
vlaaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddild
awgkaygviadvfiqveadlyaqave

Sequence, based on observed residues (ATOM records): (download)

>d3tldb_ a.1.1.2 (B:) Bacterial dimeric hemoglobin {Vitreoscilla stercoraria [TaxId: 61]}
mldqqtiniikatvpvlkehgvtitttffknlfakhpevrplfdmgesleqpkalamtvl
aaaqnienlpailpavkkiavkhcqagvaaahypivgqellgaikevlgdaatddildaw
gkaygviadvfiqveadlyaqave

SCOPe Domain Coordinates for d3tldb_:

Click to download the PDB-style file with coordinates for d3tldb_.
(The format of our PDB-style files is described here.)

Timeline for d3tldb_: