Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
Protein automated matches [197331] (11 species) not a true protein |
Species Mesobuthus tamulus [TaxId:34647] [255376] (18 PDB entries) |
Domain d2mena1: 2men A:3-33 [256425] Other proteins in same PDB: d2mena2 automated match to d1scya_ mutant |
PDB Entry: 2men (more details)
SCOPe Domain Sequences for d2mena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mena1 g.3.7.2 (A:3-33) automated matches {Mesobuthus tamulus [TaxId: 34647]} afcnlrrcelscaslgllgkcigeeckcvpy
Timeline for d2mena1: