Lineage for d1fb3b1 (1fb3 B:1067-1207)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60175Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 60206Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (1 PDB entry)
  8. 60208Domain d1fb3b1: 1fb3 B:1067-1207 [25642]
    Other proteins in same PDB: d1fb3a2, d1fb3b2

Details for d1fb3b1

PDB Entry: 1fb3 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

SCOP Domain Sequences for d1fb3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb3b1 b.43.4.2 (B:1067-1207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum)}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

SCOP Domain Coordinates for d1fb3b1:

Click to download the PDB-style file with coordinates for d1fb3b1.
(The format of our PDB-style files is described here.)

Timeline for d1fb3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fb3b2