Lineage for d1fb3b2 (1fb3 B:1208-1362)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68883Species Paprika (Capsicum annuum) [TaxId:4072] [52348] (1 PDB entry)
  8. 68885Domain d1fb3b2: 1fb3 B:1208-1362 [31532]
    Other proteins in same PDB: d1fb3a1, d1fb3b1

Details for d1fb3b2

PDB Entry: 1fb3 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

SCOP Domain Sequences for d1fb3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb3b2 c.25.1.1 (B:1208-1362) Ferredoxin reductase (flavodoxin reductase) {Paprika (Capsicum annuum)}
dpnatvimlgtgtgiapfrsflwkmffekhddykfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqtnekgekmyiqtrmaqyaeelwtllkkdntfvymcglkgmeq
giddimsslaakegidwadykkqlkkaeqwnvevy

SCOP Domain Coordinates for d1fb3b2:

Click to download the PDB-style file with coordinates for d1fb3b2.
(The format of our PDB-style files is described here.)

Timeline for d1fb3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fb3b1