Lineage for d1fb3b1 (1fb3 B:1067-1207)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14603Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families) (S)
  5. 14604Family b.43.1.1: Reductases [50414] (4 proteins)
  6. 14608Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species)
  7. Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (1 PDB entry)
  8. Domain d1fb3b1: 1fb3 B:1067-1207 [25642]
    Other proteins in same PDB: d1fb3a2, d1fb3b2

Details for d1fb3b1

PDB Entry: 1fb3 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

SCOP Domain Sequences for d1fb3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb3b1 b.43.1.1 (B:1067-1207) Ferredoxin reductase (flavodoxin reductase) {Paprika (Capsicum annuum)}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

SCOP Domain Coordinates for d1fb3b1 are not available.

Timeline for d1fb3b1:

Domains from same chain:
(mouse over for more information)
d1fb3b2
Domains from other chains:
(mouse over for more information)
d1fb3a1, d1fb3a2