![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) ![]() |
![]() | Family b.42.5.1: Fascin [50406] (1 protein) automatically mapped to Pfam PF06268 |
![]() | Protein Fascin [50407] (1 species) duplication: tandem repeat of four domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries) |
![]() | Domain d1dfcb4: 1dfc B:2383-2493 [25623] |
PDB Entry: 1dfc (more details), 2.9 Å
SCOPe Domain Sequences for d1dfcb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfcb4 b.42.5.1 (B:2383-2493) Fascin {Human (Homo sapiens) [TaxId: 9606]} rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey
Timeline for d1dfcb4:
![]() Domains from other chains: (mouse over for more information) d1dfca1, d1dfca2, d1dfca3, d1dfca4 |