Lineage for d1dfcb3 (1dfc B:2260-2382)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. Domain d1dfcb3: 1dfc B:2260-2382 [25622]

Details for d1dfcb3

PDB Entry: 1dfc (more details), 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein
PDB Compounds: (B:) fascin

SCOPe Domain Sequences for d1dfcb3:

Sequence, based on SEQRES records: (download)

>d1dfcb3 b.42.5.1 (B:2260-2382) Fascin {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstrqgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtlta
tggvqstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmk
lin

Sequence, based on observed residues (ATOM records): (download)

>d1dfcb3 b.42.5.1 (B:2260-2382) Fascin {Human (Homo sapiens) [TaxId: 9606]}
caqvvlqaanernvstdlsanqdeetdqetfqleidrdtkkcafrthtgkywtltatggv
qstassknascyfdiewrdrritlrasngkfvtskkngqlaasvetagdselflmklin

SCOPe Domain Coordinates for d1dfcb3 are not available.

Timeline for d1dfcb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfcb1, d1dfcb2, d1dfcb4
View in 3D
Domains from other chains:
(mouse over for more information)
d1dfca1, d1dfca2, d1dfca3, d1dfca4