Lineage for d1dfca4 (1dfc A:1383-1493)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. Family b.42.5.1: Fascin [50406] (1 protein)
    automatically mapped to Pfam PF06268
  6. Protein Fascin [50407] (1 species)
    duplication: tandem repeat of four domains
  7. Species Human (Homo sapiens) [TaxId:9606] [50408] (18 PDB entries)
  8. Domain d1dfca4: 1dfc A:1383-1493 [25619]

Details for d1dfca4

PDB Entry: 1dfc (more details), 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein
PDB Compounds: (A:) fascin

SCOPe Domain Sequences for d1dfca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]}
rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt
ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey

SCOPe Domain Coordinates for d1dfca4 are not available.

Timeline for d1dfca4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfca1, d1dfca2, d1dfca3
View in 3D
Domains from other chains:
(mouse over for more information)
d1dfcb1, d1dfcb2, d1dfcb3, d1dfcb4