SCOP 1.57: Domain d1dfcb2: 1dfc B:2141-2259

Lineage for d1dfcb2 (1dfc B:2141-2259)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.42: beta-Trefoil [50352] (5 superfamilies)

4. Superfamily b.42.5: Actin-crosslinking proteins [50405] (2 families)

5. Family b.42.5.1: Fascin [50406] (1 protein)

6. Protein Fascin [50407] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50408] (1 PDB entry)

8. Domain d1dfcb2: 1dfc B:2141-2259 [25621]

Details for d1dfcb2

PDB Entry: 1dfc, 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein

SCOP Domain Sequences for d1dfcb2:

Sequence; same for both SEQRES and ATOM records:

>d1dfcb2 b.42.5.1 (B:2141-2259) Fascin {Human (Homo sapiens)}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

Timeline for d1dfcb2:

• d1dfcb2 first appeared (with stable ids) in SCOP 1.55
  
• d1dfcb2 appears in SCOP 1.59
  
• d1dfcb2 appears in the current release, SCOPe 2.08