Lineage for d1dfcb2 (1dfc B:2141-2259)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14401Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 14585Superfamily b.42.5: Actin-crosslinking proteins [50405] (2 families) (S)
  5. 14586Family b.42.5.1: Fascin [50406] (1 protein)
  6. 14587Protein Fascin [50407] (1 species)
  7. 14588Species Human (Homo sapiens) [TaxId:9606] [50408] (1 PDB entry)
  8. 14594Domain d1dfcb2: 1dfc B:2141-2259 [25621]

Details for d1dfcb2

PDB Entry: 1dfc (more details), 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein

SCOP Domain Sequences for d1dfcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfcb2 b.42.5.1 (B:2141-2259) Fascin {Human (Homo sapiens)}
qvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdg
rlvarpepatgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqs

SCOP Domain Coordinates for d1dfcb2:

Click to download the PDB-style file with coordinates for d1dfcb2.
(The format of our PDB-style files is described here.)

Timeline for d1dfcb2: