Lineage for d1dfcb4 (1dfc B:2383-2493)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 59852Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 60059Superfamily b.42.5: Actin-crosslinking proteins [50405] (2 families) (S)
  5. 60060Family b.42.5.1: Fascin [50406] (1 protein)
  6. 60061Protein Fascin [50407] (1 species)
  7. 60062Species Human (Homo sapiens) [TaxId:9606] [50408] (1 PDB entry)
  8. 60070Domain d1dfcb4: 1dfc B:2383-2493 [25623]

Details for d1dfcb4

PDB Entry: 1dfc (more details), 2.9 Å

PDB Description: crystal structure of human fascin, an actin-crosslinking protein

SCOP Domain Sequences for d1dfcb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfcb4 b.42.5.1 (B:2383-2493) Fascin {Human (Homo sapiens)}
rpiivfrgehgfigcrkvtgtldanrssydvfqlefndgaynikdstgkywtvgsdsavt
ssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasaetvdpaslwey

SCOP Domain Coordinates for d1dfcb4:

Click to download the PDB-style file with coordinates for d1dfcb4.
(The format of our PDB-style files is described here.)

Timeline for d1dfcb4: