Lineage for d1dqga_ (1dqg A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 229692Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 229831Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 229874Family b.42.2.2: Cysteine rich domain [50379] (1 protein)
  6. 229875Protein Mannose receptor [50380] (1 species)
  7. 229876Species Mouse (Mus musculus) [TaxId:10090] [50381] (4 PDB entries)
  8. 229877Domain d1dqga_: 1dqg A: [25579]
    complexed with so4

Details for d1dqga_

PDB Entry: 1dqg (more details), 1.7 Å

PDB Description: crystal structure of the cysteine rich domain of mannose receptor

SCOP Domain Sequences for d1dqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus)}
darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
vygttddlcsrgye

SCOP Domain Coordinates for d1dqga_:

Click to download the PDB-style file with coordinates for d1dqga_.
(The format of our PDB-style files is described here.)

Timeline for d1dqga_: