| Class b: All beta proteins [48724] (178 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species) |
| Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries) |
| Domain d1xyfb1: 1xyf B:813-936 [25578] Other proteins in same PDB: d1xyfa2, d1xyfb2 |
PDB Entry: 1xyf (more details), 1.9 Å
SCOPe Domain Sequences for d1xyfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyfb1 b.42.2.1 (B:813-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt
Timeline for d1xyfb1: