Lineage for d1xyfa1 (1xyf A:313-436)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401803Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 2401808Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 2401809Domain d1xyfa1: 1xyf A:313-436 [25577]
    Other proteins in same PDB: d1xyfa2, d1xyfb2

Details for d1xyfa1

PDB Entry: 1xyf (more details), 1.9 Å

PDB Description: endo-1,4-beta-xylanase from streptomyces olivaceoviridis
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d1xyfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyfa1 b.42.2.1 (A:313-436) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOPe Domain Coordinates for d1xyfa1:

Click to download the PDB-style file with coordinates for d1xyfa1.
(The format of our PDB-style files is described here.)

Timeline for d1xyfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xyfa2