SCOPe 2.02: Domain d2irta_: 2irt A:

Lineage for d2irta_ (2irt A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)

6. Protein Interleukin-1 receptor antagonist protein [50366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries)

8. Domain d2irta_: 2irt A: [25557]
   CA-atoms only

Details for d2irta_

PDB Entry: 2irt, 3.2 Å

PDB Description: initial crystallographic analyses of a recombinant interleukin-1 receptor antagonist protein

PDB Compounds: (A:) interleukin-1 receptor antagonist

SCOPe Domain Sequences for d2irta_:

Sequence; same for both SEQRES and ATOM records:

>d2irta_ b.42.1.2 (A:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens) [TaxId: 9606]}
skmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmcl
scvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctamea
dqpvsltnmpdegvmvtkfyfqede

Timeline for d2irta_:

• d2irta_ first appeared (with stable ids) in SCOP 1.55
  
• d2irta_ appears in SCOPe 2.01
  
• d2irta_ appears in SCOPe 2.03
  
• d2irta_ appears in the current release, SCOPe 2.08