Lineage for d2irta_ (2irt A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (3 proteins) 
Protein Interleukin-1 receptor antagonist protein [50366] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50367] (5 PDB entries) 
Domain d2irta_: 2irt A: [25557]
Details for d2irta_
PDB Entry: 2irt (more details), 3.2 Å
PDB Description: initial crystallographic analyses of a recombinant interleukin-1 receptor antagonist protein
SCOP Domain Sequences for d2irta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2irta_ b.42.1.2 (A:) Interleukin-1 receptor antagonist protein {Human (Homo sapiens)}
skmqafriwdvnqktfylrnnqlvagylqgpnvnleekidvvpiephalflgihggkmcl
scvksgdetrlqleavnitdlsenrkqdkrfafirsdsgpttsfesaacpgwflctamea
dqpvsltnmpdegvmvtkfyfqede
SCOP Domain Coordinates for d2irta_:
Click to download the PDB-style file with coordinates for d2irta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2irta_:
- d2irta_ appears in SCOP 1.57
- d2irta_ appears in the current release, SCOPe 2.08
View in 3D
