Lineage for d1evtb_ (1evt B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951554Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 951555Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 951556Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 951570Species Human (Homo sapiens) [TaxId:9606] [50359] (31 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 951648Domain d1evtb_: 1evt B: [25528]
    Other proteins in same PDB: d1evtc1, d1evtc2, d1evtd1, d1evtd2
    complexed with so4

Details for d1evtb_

PDB Entry: 1evt (more details), 2.8 Å

PDB Description: crystal structure of fgf1 in complex with the extracellular ligand binding domain of fgf receptor 1 (fgfr1)
PDB Compounds: (B:) protein (fibroblast growth factor 1)

SCOPe Domain Sequences for d1evtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evtb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvs

SCOPe Domain Coordinates for d1evtb_:

Click to download the PDB-style file with coordinates for d1evtb_.
(The format of our PDB-style files is described here.)

Timeline for d1evtb_: