SCOPe 2.07: Domain d4ovsb1: 4ovs B:22-330

Lineage for d4ovsb1 (4ovs B:22-330)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Sulfurospirillum deleyianum [TaxId:525898] [256378] (1 PDB entry)

8. Domain d4ovsb1: 4ovs B:22-330 [254066]
   Other proteins in same PDB: d4ovsa2, d4ovsb2
   automated match to d2ceya_
   complexed with cl, sin

Details for d4ovsb1

PDB Entry: 4ovs, 1.8 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfurospirillum deleyianum dsm 6946 (sdel_0447), target efi-510309, with bound succinate

PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ovsb1:

Sequence; same for both SEQRES and ATOM records:

>d4ovsb1 c.94.1.0 (B:22-330) automated matches {Sulfurospirillum deleyianum [TaxId: 525898]}
aeytikvthvvspntpkgkgadffakrvgeltngkvevivfpnsqlygdgeemkalklgn
ahiampsfskftslvpemqlfdlpfifrdkdhlykvldgevgqilkdkvskkgfvaldyw
dagfkhlssnkkpillpedaagqkfrimsshvleaqfkavganpqvlpfsevysalqqgv
vdgaenplsnfytkkfnevqtdltlsnhgylgylvimsesfwkkfpkdlkpmvlqamkea
teyerkeaalddedmlakiseyakasgnlkihtltpeqkaawqkameaiypqfyktiged
likkvqavk

Timeline for d4ovsb1:

• d4ovsb1 first appeared in SCOPe 2.04, called d4ovsb_
  
• d4ovsb1 appears in SCOPe 2.06
  
• d4ovsb1 appears in the current release, SCOPe 2.08