Lineage for d2ceya_ (2cey A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521996Protein Sialic acid-binding protein SiaP [254345] (1 species)
    Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222
  7. 2521997Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries)
  8. 2522000Domain d2ceya_: 2cey A: [241451]
    complexed with zn

Details for d2ceya_

PDB Entry: 2cey (more details), 1.7 Å

PDB Description: apo structure of siap
PDB Compounds: (A:) protein hi0146

SCOPe Domain Sequences for d2ceya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ceya_ c.94.1.1 (A:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

SCOPe Domain Coordinates for d2ceya_:

Click to download the PDB-style file with coordinates for d2ceya_.
(The format of our PDB-style files is described here.)

Timeline for d2ceya_: