| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
| Protein Sialic acid-binding protein SiaP [254345] (1 species) Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222 |
| Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries) |
| Domain d2ceya_: 2cey A: [241451] complexed with zn |
PDB Entry: 2cey (more details), 1.7 Å
SCOPe Domain Sequences for d2ceya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ceya_ c.94.1.1 (A:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp
Timeline for d2ceya_: