Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins) barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms |
Protein Gene 32 protein (gp32) core [50319] (2 species) contains a Zn-finger subdomain, res. 63-111 |
Species Bacteriophage T4 [TaxId:10665] [50320] (1 PDB entry) |
Domain d1gpca_: 1gpc A: [25393] protein/DNA complex; complexed with zn |
PDB Entry: 1gpc (more details), 2.2 Å
SCOPe Domain Sequences for d1gpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpca_ b.40.4.7 (A:) Gene 32 protein (gp32) core {Bacteriophage T4 [TaxId: 10665]} gfssedkgewklkldnagngqavirflpskndeqapfailvnhgfkkngkwyietcssth gdydscpvcqyiskndlyntdnkeyslvkrktsywanilvvkdpaapenegkvfkyrfgk kiwdkinamiavdvemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipnid desfqkelfeqmvdlsemtskdkfksfeelntkfgqvm
Timeline for d1gpca_: