Lineage for d1gpc__ (1gpc -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.7: Filamentous bacteriophage ssDNA-binding proteins [50315] (2 proteins) 
Protein Gene 32 protein (GP32) core [50319] (1 species) Species Bacteriophage T4 [TaxId:10665] [50320] (1 PDB entry) 
Domain d1gpc__: 1gpc - [25393]
Details for d1gpc__
PDB Entry: 1gpc (more details), 2.2 Å
PDB Description: core gp32, dna-binding protein
SCOP Domain Sequences for d1gpc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpc__ b.40.4.7 (-) Gene 32 protein (GP32) core {Bacteriophage T4}
gfssedkgewklkldnagngqavirflpskndeqapfailvnhgfkkngkwyietcssth
gdydscpvcqyiskndlyntdnkeyslvkrktsywanilvvkdpaapenegkvfkyrfgk
kiwdkinamiavdvemgetpvdvtcpweganfvlkvkqvsgfsnydeskflnqsaipnid
desfqkelfeqmvdlsemtskdkfksfeelntkfgqvm
SCOP Domain Coordinates for d1gpc__:
Click to download the PDB-style file with coordinates for d1gpc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gpc__:
- d1gpc__ appears in SCOP 1.57
- d1gpc__ appears in the current release, SCOPe 2.08, called d1gpca_
View in 3D