SCOPe 2.07: Domain d4n6bf_: 4n6b F:

Lineage for d4n6bf_ (4n6b F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (35 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [228990] (3 PDB entries)

8. Domain d4n6bf_: 4n6b F: [253912]
   automated match to d3gvdc_
   complexed with coa

Details for d4n6bf_

PDB Entry: 4n6b, 3 Å

PDB Description: Soybean Serine Acetyltransferase Complexed with CoA

PDB Compounds: (F:) Serine Acetyltransferase Apoenzyme

SCOPe Domain Sequences for d4n6bf_:

Sequence, based on SEQRES records:

>d4n6bf_ b.81.1.0 (F:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
lflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllwrqsr
rplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggt
gkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv

Sequence, based on observed residues (ATOM records):

>d4n6bf_ b.81.1.0 (F:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
lflnafssdpslrsaavadlraarerdsyshcllnykgflacqahrvahllwrqsrrpla
lalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggtggdr
hpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv

Timeline for d4n6bf_:

• d4n6bf_ first appeared in SCOPe 2.04
  
• d4n6bf_ appears in SCOPe 2.06
  
• d4n6bf_ appears in the current release, SCOPe 2.08