Lineage for d4n6bf_ (4n6b F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (31 species)
    not a true protein
  7. 2403668Species Soybean (Glycine max) [TaxId:3847] [228990] (3 PDB entries)
  8. 2403678Domain d4n6bf_: 4n6b F: [253912]
    automated match to d3gvdc_
    complexed with coa

Details for d4n6bf_

PDB Entry: 4n6b (more details), 3 Å

PDB Description: Soybean Serine Acetyltransferase Complexed with CoA
PDB Compounds: (F:) Serine Acetyltransferase Apoenzyme

SCOPe Domain Sequences for d4n6bf_:

Sequence, based on SEQRES records: (download)

>d4n6bf_ b.81.1.0 (F:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
lflnafssdpslrsaavadlraarerdpacvsyshcllnykgflacqahrvahllwrqsr
rplalalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggt
gkvggdrhpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv

Sequence, based on observed residues (ATOM records): (download)

>d4n6bf_ b.81.1.0 (F:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
egwvwgqikaearrdaesepalasylystilshsslerslsfhlgnklcsstllstllyd
lflnafssdpslrsaavadlraarerdsyshcllnykgflacqahrvahllwrqsrrpla
lalhsrianvfavdihpaarigkgilfdhatgvvvgetavignnvsilhhvtlggtggdr
hpkigdgvligagatilgnikigegakvgagsvvlidvpprttavgnparlv

SCOPe Domain Coordinates for d4n6bf_:

Click to download the PDB-style file with coordinates for d4n6bf_.
(The format of our PDB-style files is described here.)

Timeline for d4n6bf_: