Lineage for d4n5yu_ (4n5y U:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778469Domain d4n5yu_: 4n5y U: [253901]
    Other proteins in same PDB: d4n5yb_, d4n5yd_, d4n5yf_, d4n5yh_, d4n5yj_, d4n5yl_, d4n5yn_, d4n5yp_, d4n5yr_, d4n5yt_, d4n5yv_, d4n5yx_, d4n5yz_
    automated match to d3gbna_
    complexed with nag; mutant

Details for d4n5yu_

PDB Entry: 4n5y (more details), 3.16 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n158d, n224k and q226l) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (U:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4n5yu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5yu_ b.19.1.2 (U:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dpgdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsv
agwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqii
pksswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwg
ihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpnd
ainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpl
tigecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d4n5yu_:

Click to download the PDB-style file with coordinates for d4n5yu_.
(The format of our PDB-style files is described here.)

Timeline for d4n5yu_: