Lineage for d4n5yt_ (4n5y T:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969908Domain d4n5yt_: 4n5y T: [253900]
    Other proteins in same PDB: d4n5ya_, d4n5yc_, d4n5ye_, d4n5yg_, d4n5yi_, d4n5yk_, d4n5ym_, d4n5yo_, d4n5yq_, d4n5ys_, d4n5yu_, d4n5yw_, d4n5yy_
    automated match to d4n5zb_
    complexed with nag; mutant

Details for d4n5yt_

PDB Entry: 4n5y (more details), 3.16 Å

PDB Description: crystal structure of h5 hemagglutinin mutant (n158d, n224k and q226l) from the influenza virus a/viet nam/1203/2004 (h5n1)
PDB Compounds: (T:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4n5yt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5yt_ h.3.1.1 (T:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr

SCOPe Domain Coordinates for d4n5yt_:

Click to download the PDB-style file with coordinates for d4n5yt_.
(The format of our PDB-style files is described here.)

Timeline for d4n5yt_: