![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries) |
![]() | Domain d4n5yh_: 4n5y H: [253888] Other proteins in same PDB: d4n5ya_, d4n5yc_, d4n5ye_, d4n5yg_, d4n5yi_, d4n5yk_, d4n5ym_, d4n5yo_, d4n5yq_, d4n5ys_, d4n5yu_, d4n5yw_, d4n5yy_ automated match to d4n5zb_ complexed with nag; mutant |
PDB Entry: 4n5y (more details), 3.16 Å
SCOPe Domain Sequences for d4n5yh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n5yh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeissgr
Timeline for d4n5yh_: