SCOPe 2.07: Domain d4m4ec1: 4m4e C:292-466

Lineage for d4m4ec1 (4m4e C:292-466)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.0: automated matches [227285] (1 protein)
   not a true family

6. Protein automated matches [227102] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256340] (2 PDB entries)

8. Domain d4m4ec1: 4m4e C:292-466 [253740]
   Other proteins in same PDB: d4m4ec2
   automated match to d1lb4a_

Details for d4m4ec1

PDB Entry: 4m4e, 2.6 Å

PDB Description: TRAF domain of human TRAF4

PDB Compounds: (C:) TNF receptor-associated factor 4

SCOPe Domain Sequences for d4m4ec1:

Sequence, based on SEQRES records:

>d4m4ec1 b.8.1.0 (C:292-466) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqelrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaf
lngngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhpd
pnwknfqkpgtwrgsldesslgfgypkfishqdirkrnyvrddavfiraavelpr

Sequence, based on observed residues (ATOM records):

>d4m4ec1 b.8.1.0 (C:292-466) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqelrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaf
lngngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpgkpqhvtetfhpdpn
wknfqkpgtlgfgypkfishqdirkrnyvrddavfiraavelpr

Timeline for d4m4ec1:

• d4m4ec1 first appeared in SCOPe 2.04, called d4m4ec_
  
• d4m4ec1 appears in SCOPe 2.06
  
• d4m4ec1 appears in the current release, SCOPe 2.08