![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
![]() | Family b.8.1.0: automated matches [227285] (1 protein) not a true family |
![]() | Protein automated matches [227102] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256340] (2 PDB entries) |
![]() | Domain d4m4ec1: 4m4e C:292-466 [253740] Other proteins in same PDB: d4m4ec2 automated match to d1lb4a_ |
PDB Entry: 4m4e (more details), 2.6 Å
SCOPe Domain Sequences for d4m4ec1:
Sequence, based on SEQRES records: (download)
>d4m4ec1 b.8.1.0 (C:292-466) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqelrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaf lngngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhpd pnwknfqkpgtwrgsldesslgfgypkfishqdirkrnyvrddavfiraavelpr
>d4m4ec1 b.8.1.0 (C:292-466) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqelrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaf lngngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpgkpqhvtetfhpdpn wknfqkpgtlgfgypkfishqdirkrnyvrddavfiraavelpr
Timeline for d4m4ec1: